9,118 registered domains — Last update: 20 May 2026
Domain list for .HEALTHCARE zone - full list of registered domain names for the zone
Sample data:
0511apo.healthcare 120.healthcare 23andme.healthcare 3081.healthcare 3stepdetect.healthcare 626.healthcare 8k.healthcare aandj.healthcare abcminerals.healthcare ablynx.healthcare abridge.healthcare abundant.healthcare acareerathca.healthcare accesswellness.healthcare accreditation.healthcare acir.healthcare activphy.healthcare adarana.healthcare adezkibart.healthcare adp.healthcare advance.healthcare advancingforreading.healthcare advent.healthcare aegis-i.healthcare aesthetic.healthcare afford.healthcare afya.healthcare agfa.healthcare ahead.healthcare ai4.healthcare aidocs.healthcare aimovig.healthcare airclinic.healthcare aiuniv.healthcare akupunktur.healthcare alcon.healthcare algofan.healthcare alis.healthcare allen.healthcare alleviakensingtonhospital.healthcare allmed.healthcare allview.healthcare alnylamclinicaltrials.healthcare alpine.healthcare altaisconsulting.healthcare altaistechnology.healthcare altiveramedical.healthcare am-hip.healthcare amazonapothecary.healthcare amazonmedicine.healthcare amazonpharmaceutical.healthcare amazonpilpak.healthcare amazonrx.healthcare amberg.healthcare americansfirst.healthcare amie.healthcare ample.healthcare anacrusis.healthcare and.healthcare angelinipharma.healthcare annaliese.healthcare anti-pd1.healthcare anything.healthcare aph.healthcare apollohl.healthcare app.healthcare appriss.healthcare arabunion.healthcare archi.healthcare aristacarehealth.healthcare arnoldpalmerhospital.healthcare ars.healthcare as.healthcare ascensionkansas.healthcare ascentium.healthcare ask.healthcare aspiration.healthcare association.healthcare astron.healthcare atiya.healthcare atoz.healthcare atriumhealthlivewell.healthcare atriumphysicians.healthcare audiology.healthcare aura.healthcare australianworkplace.healthcare authormedicalgroup.healthcare autonomous.healthcare avaligntechnologies.healthcare avanza-health.healthcare avia.healthcare awards.healthcare axon.healthcare ayurvedic.healthcare babcock.healthcare baines.healthcare banks.healthcare basic-fit.healthcare baycommunity.healthcare bcbsmt.healthcare beaubrain.healthcare behave.healthcare bellistherapy.healthcare benefitsinc.healthcare benistarlawsuits.healthcare best-health.healthcare betterhealthwi.healthcare beviper.healthcare big.healthcare bingx.healthcare biogen.healthcare bioon.healthcare biovida.healthcare bislyta-hcp.healthcare blackmountain.healthcare blockchain.healthcare bluebrix.healthcare bluerenew.healthcare bmh.healthcare boehringeraccess.healthcare bookable.healthcare borlandgroover.healthcare botanist.healthcare bozemanhealthbsmc.healthcare brandnet.healthcare breastcheck.healthcare bridge.healthcare brightinsight.healthcare british.healthcare bryvigo.healthcare bunzl.healthcare butterfly.healthcare byrula.healthcare cadencerpm.healthcare callcare.healthcare cambia.healthcare cancercarenow.healthcare canopy.healthcare capvest.healthcare care-connect.healthcare carebnb.healthcare careconnect365.healthcare careflow.healthcare carelancers.healthcare carenethealthhub.healthcare carepro.healthcare carevitalitymarketplace.healthcare cariregen.healthcare carolinasphysiciansnetwork.healthcare cash.healthcare catherinefortin.healthcare cbdmiracle.healthcare ccmc.healthcare cdr.healthcare celesio.healthcare censeocontractors.healthcare centerview.healthcare cep.healthcare cernerenviza.healthcare ch.healthcare channels.healthcare charlesriver.healthcare chautauqua.healthcare chemdx.healthcare chicago.healthcare childrensdentalcenter.healthcare chocchildrens.healthcare chosenhealth.healthcare chsatriumhealth.healthcare cih.healthcare circadian.healthcare cityoftyler.healthcare clarityai.healthcare cleaningforhealth.healthcare clearpower.healthcare click-arznei.healthcare clickgesund.healthcare clinicalethics.healthcare clinix.healthcare clover.healthcare cns.healthcare cobrahealthcoverage.healthcare cohese.healthcare collective.healthcare coloradotechnicaluniversity.healthcare commandcenter.healthcare commonspirithealth.healthcare communityhealthtechnologies.healthcare compassonly.healthcare compliant.healthcare conciel.healthcare confound.healthcare connectus.healthcare consult-a-nurse.healthcare continuitycaregroups.healthcare coolangattaskinandtravelclinic.healthcare copc.healthcare core.healthcare corewellsouth.healthcare corr.healthcare costplus.healthcare covalon.healthcare covidtest.healthcare cpr.healthcare crea.healthcare cretreatment.healthcare croker.healthcare cs.healthcare csp.healthcare cubist.healthcare cura.healthcare cureos.healthcare cvmc.healthcare cyber.healthcare cynergy.healthcare cytologie.healthcare daisy.healthcare dandelion.healthcare dash.healthcare datafluent.healthcare datenschutz.healthcare dayes.healthcare dear.healthcare dedalus.healthcare definitive.healthcare delsolmedicalcenter.healthcare dental-implants.healthcare dentistsraleighnc.healthcare dermatology.healthcare destinationforwardhemophilia.healthcare dhv.healthcare dibamed.healthcare digit.healthcare digitalindia.healthcare diligent.healthcare directpay.healthcare disrupt.healthcare divorcepawns.healthcare dnli.healthcare doccla.healthcare doctor.healthcare doerr.healthcare domiciliary.healthcare donttrustmoodychildrens.healthcare dot.healthcare dr-kade.healthcare drb.healthcare dreamscapemarketing.healthcare drk-hausruf.healthcare drsachs.healthcare dtl.healthcare dukemedicine.healthcare dynamiccare.healthcare eakin.healthcare easycare.healthcare ecareaccess.healthcare eco-health.healthcare ede.healthcare efs.healthcare einfachia.healthcare elderly-care.healthcare elevatedmedia.healthcare elizabethtown.healthcare elmed.healthcare elveka.healthcare emeis-group.healthcare emmy.healthcare empathiq.healthcare empowered.healthcare enabled.healthcare energizedhealth.healthcare enli.healthcare ensemble.healthcare entyrecare.healthcare eosynq.healthcare epigenethic.healthcare epsi.healthcare eqx.healthcare eroll.healthcare essity.healthcare ethical.healthcare euris.healthcare everlastinghopesc.healthcare everso.healthcare evidex.healthcare evoo.healthcare exactsciences.healthcare exclusive.healthcare expressscriptspharmacy.healthcare eyeq.healthcare eziclen.healthcare faircare.healthcare family1stchiropractic.healthcare farmako.healthcare fdb.healthcare feminity.healthcare fhir-cdr.healthcare fin.healthcare finds.healthcare firstpartypayer.healthcare fitnessyourself.healthcare flora.healthcare fluent.healthcare fmc-na.healthcare foleyandlardner.healthcare forge.healthcare forth.healthcare foundermentalhealth.healthcare fractal.healthcare free2gp.healthcare freemancancerinst.healthcare freemanhealth.healthcare freemanmoms.healthcare freemanorthosport.healthcare freemansmartscore.healthcare freemanwoundcare.healthcare freiblick.healthcare froedterttheda.healthcare fsa.healthcare fullbodypredictivemedicine.healthcare fusion.healthcare gaba.healthcare gale.healthcare gather.healthcare gcfas.healthcare gemini.healthcare generic.healthcare genevant.healthcare georgiaaccess.healthcare getcoverage.healthcare ghhospital.healthcare gig.healthcare gim.healthcare giveatriumhealthcare.healthcare glidden.healthcare gloryhealth.healthcare go2.healthcare goldenheart.healthcare goodsam.healthcare gpnearme.healthcare gramnegtreatment.healthcare greatergood.healthcare greensky.healthcare grow.healthcare gsh.healthcare guidance-center.healthcare gzt.healthcare haadi.healthcare haiping.healthcare haltern.healthcare handtherapy.healthcare happy.healthcare harmonie.healthcare hatmc.healthcare hays.healthcare hcaflorida.healthcare hchb.healthcare hdfc.healthcare healin.healthcare health2healthy.healthcare healthcity.healthcare healthhub.healthcare healthmatch.healthcare healthroi.healthcare healthware.healthcare healthythursday.healthcare heartfeltcare.healthcare helen.healthcare helping.healthcare hemp.healthcare hepatisb-med.healthcare hepatitisbmed.healthcare hepb-md-sucks.healthcare hepbmd.healthcare hepmed.healthcare herdiabetes.healthcare herrelief.healthcare hhc.healthcare highvalue.healthcare himsandhershealth.healthcare hiprahumanhealth.healthcare hive.healthcare hni.healthcare holahealth.healthcare home.healthcare homelink.healthcare homesight.healthcare hopkins.healthcare hornung.healthcare housecalls.healthcare hr.healthcare hubble.healthcare humain.healthcare humanly.healthcare hvl.healthcare hygieia.healthcare hyperpipe.healthcare i-o.healthcare ibis.healthcare ibxtpa.healthcare ichra.healthcare idds.healthcare ids.healthcare ihacares.healthcare ihub.healthcare ilyn.healthcare imed.healthcare immotiss.healthcare impactclinic.healthcare implied.healthcare imwm.healthcare included.healthcare inez.healthcare informationtechnologyandservices.healthcare inhealth.healthcare innovacorium.healthcare inpsyde.healthcare inspiration.healthcare instrumentarium.healthcare integratedhealthcareassociates.healthcare intelligent.healthcare intermedmedical.healthcare intradoc247.healthcare investor.healthcare invivo.healthcare ipif.healthcare irdtreatment.healthcare islamic.healthcare itech.healthcare iuhealth.healthcare j-j.healthcare janus.healthcare jesus.healthcare jingxi.healthcare jobsabroad.healthcare joinsparkspecialist.healthcare joysbio.healthcare jupiter.healthcare kailera.healthcare kanzlei.healthcare kasfero.healthcare kcuchealthcare.healthcare kem-hip.healthcare keystonecare.healthcare kidneys.healthcare kings.healthcare kismet.healthcare klickapo.healthcare kmi.healthcare koa.healthcare konnekt.healthcare kp.healthcare kushty.healthcare labcorgenetic.healthcare laboratoires-urgo.healthcare labxpress.healthcare landmark.healthcare laspalmasmedicalcenter.healthcare lawn.healthcare lead.healthcare leantaas.healthcare leerink.healthcare leidos.healthcare lequest.healthcare levinechildrens.healthcare lichen.healthcare lifecenter.healthcare lifeguard.healthcare lifenhealthemporium.healthcare lifeworksnw.healthcare lindemann.healthcare lirio.healthcare livein.healthcare livongo.healthcare locum.healthcare longevity.healthcare loveyoureyes.healthcare ltcally.healthcare lumen.healthcare lumyo.healthcare luxturnagenetherapy.healthcare luxury.healthcare lyrahealth.healthcare m3india-alerts.healthcare madrigalpharma.healthcare maha.healthcare malama.healthcare manhattanmaternity.healthcare maple.healthcare mari.healthcare maritide.healthcare masi.healthcare massmovement.healthcare maxmed.healthcare mcbride.healthcare mcneil.healthcare mdr-gni-option.healthcare meadowcrest.healthcare medacs.healthcare medchat.healthcare
| Date | Total domains | New | Deleted |
|---|---|---|---|
| 2025-06-23 | 9,345 | + 1 | - 3 |
| 2025-06-24 | 9,345 | + 2 | - 2 |
| 2025-06-25 | 9,351 | + 11 | - 5 |
| 2025-06-26 | 9,349 | + 4 | - 6 |
| 2025-06-27 | 9,351 | + 5 | - 3 |
| 2025-06-28 | 9,347 | + 2 | - 6 |
| 2025-06-29 | 9,345 | + 1 | - 3 |
| 2025-06-30 | 9,339 | + 1 | - 7 |
| 2025-07-01 | 9,343 | + 5 | - 1 |
| 2025-07-02 | 9,341 | + 2 | - 4 |
| 2025-07-03 | 9,342 | + 5 | - 4 |
| 2025-07-04 | 9,339 | + 2 | - 5 |
| 2025-07-05 | 9,339 | + 5 | - 5 |
| 2025-07-06 | 9,337 | + 1 | - 3 |
| 2025-07-07 | 9,336 | + 3 | - 4 |
| 2025-07-08 | 9,339 | + 6 | - 3 |
| 2025-07-09 | 9,334 | + 1 | - 6 |
| 2025-07-10 | 9,331 | + 2 | - 5 |
| 2025-07-11 | 9,327 | + 2 | - 6 |
| 2025-07-12 | 9,321 | + 1 | - 7 |
| 2025-07-13 | 9,318 | + 2 | - 5 |
| 2025-07-14 | 9,317 | 0 | - 1 |
| 2025-07-16 | 9,313 | + 5 | - 9 |
| 2025-07-17 | 9,312 | + 5 | - 6 |
| 2025-07-18 | 9,307 | + 2 | - 7 |
| 2025-07-19 | 9,305 | + 1 | - 3 |
| 2025-07-20 | 9,302 | + 3 | - 6 |
| 2025-07-21 | 9,308 | + 6 | 0 |
| 2025-07-22 | 9,307 | + 4 | - 5 |
| 2025-07-23 | 9,310 | + 6 | - 3 |
| 2025-07-24 | 9,298 | + 3 | - 15 |
| 2025-07-25 | 9,300 | + 6 | - 4 |
| 2025-07-26 | 9,296 | + 4 | - 8 |
| 2025-07-27 | 9,291 | + 3 | - 8 |
| 2025-07-28 | 9,285 | 0 | - 6 |
| 2025-07-29 | 9,292 | + 10 | - 3 |
| 2025-07-30 | 9,300 | + 10 | - 2 |
| 2025-07-31 | 9,293 | + 1 | - 8 |
| 2025-08-01 | 9,298 | + 8 | - 3 |
| 2025-08-02 | 9,296 | + 2 | - 4 |
| 2025-08-03 | 9,294 | 0 | - 2 |
| 2025-08-04 | 9,291 | + 1 | - 4 |
| 2025-08-05 | 9,291 | + 3 | - 3 |
| 2025-08-06 | 9,290 | + 2 | - 3 |
| 2025-08-07 | 9,287 | + 2 | - 5 |
| 2025-08-08 | 9,289 | + 6 | - 4 |
| 2025-08-09 | 9,287 | + 2 | - 4 |
| 2025-08-10 | 9,287 | + 1 | - 1 |
| 2025-08-11 | 9,286 | + 2 | - 3 |
| 2025-08-12 | 9,286 | + 3 | - 3 |
| 2025-08-13 | 9,287 | + 2 | - 1 |
| 2025-08-14 | 9,284 | + 1 | - 4 |
| 2025-08-15 | 9,288 | + 8 | - 4 |
| 2025-08-16 | 9,288 | + 2 | - 2 |
| 2025-08-17 | 9,283 | + 2 | - 7 |
| 2025-08-18 | 9,277 | + 1 | - 7 |
| 2025-08-19 | 9,278 | + 5 | - 4 |
| 2025-08-20 | 9,280 | + 6 | - 4 |
| 2025-08-21 | 9,281 | + 3 | - 2 |
| 2025-08-22 | 9,280 | + 4 | - 5 |
| 2025-08-23 | 9,278 | + 2 | - 4 |
| 2025-08-24 | 9,274 | + 2 | - 6 |
| 2025-08-25 | 9,278 | + 5 | - 1 |
| 2025-08-26 | 9,274 | + 2 | - 6 |
| 2025-08-27 | 9,270 | + 4 | - 8 |
| 2025-08-28 | 9,272 | + 3 | - 1 |
| 2025-08-29 | 9,265 | + 3 | - 10 |
| 2025-08-30 | 9,262 | 0 | - 3 |
| 2025-08-31 | 9,250 | 0 | - 12 |
| 2025-09-01 | 9,251 | + 3 | - 2 |
| 2025-09-02 | 9,252 | + 3 | - 2 |
| 2025-09-03 | 9,252 | + 2 | - 2 |
| 2025-09-04 | 9,254 | + 5 | - 3 |
| 2025-09-05 | 9,332 | + 79 | - 1 |
| 2025-09-06 | 9,336 | + 7 | - 3 |
| 2025-09-07 | 9,329 | + 1 | - 8 |
| 2025-09-08 | 9,324 | + 3 | - 8 |
| 2025-09-09 | 9,328 | + 7 | - 3 |
| 2025-09-10 | 9,330 | + 5 | - 3 |
| 2025-09-11 | 9,328 | + 3 | - 5 |
| 2025-09-12 | 9,323 | + 1 | - 6 |
| 2025-09-13 | 9,326 | + 7 | - 4 |
| 2025-09-14 | 9,324 | + 3 | - 5 |
| 2025-09-15 | 9,324 | + 2 | - 2 |
| 2025-09-16 | 9,326 | + 6 | - 4 |
| 2025-09-17 | 9,323 | + 5 | - 8 |
| 2025-09-18 | 9,327 | + 8 | - 4 |
| 2025-09-19 | 9,325 | + 1 | - 3 |
| 2025-09-20 | 9,324 | + 6 | - 7 |
| 2025-09-21 | 9,319 | + 1 | - 6 |
| 2025-09-22 | 9,320 | + 2 | - 1 |
| 2025-09-23 | 9,320 | + 4 | - 4 |
| 2025-09-24 | 9,318 | + 2 | - 4 |
| 2025-09-25 | 9,323 | + 7 | - 2 |
| 2025-09-26 | 9,324 | + 3 | - 2 |
| 2025-09-27 | 9,321 | + 2 | - 5 |
| 2025-09-28 | 9,322 | + 3 | - 2 |
| 2025-09-29 | 9,321 | 0 | - 1 |
| 2025-09-30 | 9,328 | + 9 | - 2 |
| 2025-10-01 | 9,328 | + 3 | - 3 |
| 2025-10-02 | 9,333 | + 6 | - 1 |
| 2025-10-03 | 9,332 | + 2 | - 3 |
| 2025-10-04 | 9,336 | + 9 | - 5 |
| 2025-10-05 | 9,334 | + 1 | - 3 |
| 2025-10-06 | 9,330 | 0 | - 4 |
| 2025-10-07 | 9,335 | + 8 | - 3 |
| 2025-10-08 | 9,329 | + 6 | - 12 |
| 2025-10-09 | 9,330 | + 5 | - 4 |
| 2025-10-10 | 9,331 | + 5 | - 4 |
| 2025-10-11 | 9,328 | + 3 | - 6 |
| 2025-10-12 | 9,326 | + 1 | - 3 |
| 2025-10-13 | 9,324 | + 2 | - 4 |
| 2025-10-14 | 9,322 | + 5 | - 7 |
| 2025-10-15 | 9,324 | + 4 | - 2 |
| 2025-10-16 | 9,324 | + 4 | - 4 |
| 2025-10-17 | 9,322 | + 1 | - 3 |
| 2025-10-18 | 9,325 | + 5 | - 2 |
| 2025-10-19 | 9,325 | + 1 | - 1 |
| 2025-10-20 | 9,320 | 0 | - 5 |
| 2025-10-21 | 9,316 | + 1 | - 5 |
| 2025-10-22 | 9,313 | + 1 | - 4 |
| 2025-10-23 | 9,310 | + 3 | - 6 |
| 2025-10-24 | 9,306 | + 3 | - 7 |
| 2025-10-25 | 9,302 | + 2 | - 6 |
| 2025-10-26 | 9,300 | + 1 | - 3 |
| 2025-10-27 | 9,298 | + 2 | - 4 |
| 2025-10-28 | 9,294 | + 1 | - 5 |
| 2025-10-29 | 9,304 | + 12 | - 2 |
| 2025-10-30 | 9,300 | + 1 | - 5 |
| 2025-10-31 | 9,303 | + 5 | - 2 |
| 2025-11-01 | 9,306 | + 4 | - 1 |
| 2025-11-02 | 9,303 | + 2 | - 5 |
| 2025-11-03 | 9,300 | + 3 | - 6 |
| 2025-11-04 | 9,301 | + 7 | - 6 |
| 2025-11-05 | 9,303 | + 3 | - 1 |
| 2025-11-06 | 9,300 | + 2 | - 5 |
| 2025-11-07 | 9,298 | + 3 | - 5 |
| 2025-11-08 | 9,309 | + 13 | - 2 |
| 2025-11-09 | 9,306 | + 3 | - 6 |
| 2025-11-10 | 9,308 | + 3 | - 1 |
| 2025-11-11 | 9,306 | + 2 | - 4 |
| 2025-11-12 | 9,306 | + 3 | - 3 |
| 2025-11-13 | 9,305 | + 4 | - 5 |
| 2025-11-14 | 9,302 | + 3 | - 6 |
| 2025-11-15 | 9,302 | + 3 | - 3 |
| 2025-11-16 | 9,301 | 0 | - 1 |
| 2025-11-17 | 9,306 | + 5 | 0 |
| 2025-11-18 | 9,306 | + 3 | - 3 |
| 2025-11-19 | 9,300 | + 2 | - 8 |
| 2025-11-20 | 9,305 | + 10 | - 5 |
| 2025-11-21 | 9,306 | + 2 | - 1 |
| 2025-11-22 | 9,305 | + 3 | - 4 |
| 2025-11-23 | 9,297 | + 2 | - 10 |
| 2025-11-24 | 9,297 | + 2 | - 2 |
| 2025-11-25 | 9,298 | + 4 | - 3 |
| 2025-11-26 | 9,299 | + 5 | - 4 |
| 2025-11-27 | 9,299 | + 6 | - 6 |
| 2025-11-28 | 9,299 | + 2 | - 2 |
| 2025-11-29 | 9,303 | + 6 | - 2 |
| 2025-11-30 | 9,303 | + 5 | - 5 |
| 2025-12-01 | 9,299 | 0 | - 4 |
| 2025-12-02 | 9,291 | + 3 | - 11 |
| 2025-12-03 | 9,293 | + 9 | - 7 |
| 2025-12-04 | 9,281 | + 3 | - 15 |
| 2025-12-05 | 9,275 | + 1 | - 7 |
| 2025-12-06 | 9,271 | + 4 | - 8 |
| 2025-12-07 | 9,272 | + 3 | - 2 |
| 2025-12-08 | 9,269 | + 1 | - 4 |
| 2025-12-09 | 9,269 | + 3 | - 3 |
| 2025-12-10 | 9,267 | + 4 | - 6 |
| 2025-12-11 | 9,264 | + 3 | - 6 |
| 2025-12-12 | 9,265 | + 3 | - 2 |
| 2025-12-13 | 9,257 | 0 | - 8 |
| 2025-12-14 | 9,253 | + 1 | - 5 |
| 2025-12-15 | 9,251 | + 1 | - 3 |
| 2025-12-16 | 9,252 | + 3 | - 2 |
| 2025-12-17 | 9,255 | + 5 | - 2 |
| 2025-12-18 | 9,256 | + 3 | - 2 |
| 2025-12-19 | 9,257 | + 7 | - 6 |
| 2025-12-20 | 9,256 | + 2 | - 3 |
| 2025-12-21 | 9,260 | + 6 | - 2 |
| 2025-12-22 | 9,253 | 0 | - 7 |
| 2025-12-23 | 9,255 | + 2 | 0 |
| 2025-12-24 | 9,252 | + 1 | - 4 |
| 2025-12-25 | 9,250 | 0 | - 2 |
| 2025-12-26 | 9,245 | + 3 | - 8 |
| 2025-12-27 | 9,241 | 0 | - 4 |
| 2025-12-28 | 9,245 | + 4 | 0 |
| 2025-12-29 | 9,244 | + 1 | - 2 |
| 2025-12-30 | 9,243 | + 2 | - 3 |
| 2025-12-31 | 9,242 | + 3 | - 4 |
| 2026-01-01 | 9,236 | + 1 | - 7 |
| 2026-01-02 | 9,234 | + 2 | - 4 |
| 2026-01-03 | 9,234 | + 2 | - 2 |
| 2026-01-04 | 9,232 | 0 | - 2 |
| 2026-01-05 | 9,229 | 0 | - 3 |
| 2026-01-06 | 9,226 | + 1 | - 4 |
| 2026-01-07 | 9,222 | 0 | - 4 |
| 2026-01-08 | 9,221 | + 3 | - 4 |
| 2026-01-09 | 9,221 | + 3 | - 3 |
| 2026-01-10 | 9,223 | + 4 | - 2 |
| 2026-01-11 | 9,223 | + 2 | - 2 |
| 2026-01-12 | 9,224 | + 2 | - 1 |
| 2026-01-13 | 9,225 | + 2 | - 1 |
| 2026-01-14 | 9,222 | + 1 | - 4 |
| 2026-01-15 | 9,225 | + 5 | - 2 |
| 2026-01-16 | 9,227 | + 2 | 0 |
| 2026-01-17 | 9,229 | + 5 | - 3 |
| 2026-01-18 | 9,226 | + 1 | - 4 |
| 2026-01-19 | 9,224 | + 2 | - 4 |
| 2026-01-20 | 9,226 | + 5 | - 3 |
| 2026-01-21 | 9,221 | + 7 | - 12 |
| 2026-01-22 | 9,221 | 0 | 0 |
| 2026-01-23 | 9,224 | + 13 | - 10 |
| 2026-01-24 | 9,226 | + 7 | - 5 |
| 2026-01-25 | 9,224 | 0 | - 2 |
| 2026-01-26 | 9,222 | + 1 | - 3 |
| 2026-01-27 | 9,223 | + 4 | - 3 |
| 2026-01-28 | 9,223 | + 3 | - 3 |
| 2026-01-29 | 9,227 | + 5 | - 1 |
| 2026-01-30 | 9,235 | + 13 | - 5 |
| 2026-01-31 | 9,235 | + 1 | - 1 |
| 2026-02-01 | 9,230 | 0 | - 5 |
| 2026-02-02 | 9,230 | + 1 | - 1 |
| 2026-02-03 | 9,233 | + 5 | - 2 |
| 2026-02-04 | 9,229 | + 2 | - 6 |
| 2026-02-05 | 9,231 | + 4 | - 2 |
| 2026-02-06 | 9,230 | + 3 | - 4 |
| 2026-02-07 | 9,231 | + 3 | - 2 |
| 2026-02-08 | 9,235 | + 4 | 0 |
| 2026-02-09 | 9,230 | + 1 | - 6 |
| 2026-02-10 | 9,229 | + 1 | - 2 |
| 2026-02-11 | 9,228 | + 3 | - 4 |
| 2026-02-12 | 9,223 | + 2 | - 7 |
| 2026-02-13 | 9,228 | + 7 | - 2 |
| 2026-02-14 | 9,228 | + 4 | - 4 |
| 2026-02-15 | 9,221 | + 1 | - 8 |
| 2026-02-16 | 9,218 | + 1 | - 4 |
| 2026-02-17 | 9,220 | + 3 | - 1 |
| 2026-02-18 | 9,219 | + 3 | - 4 |
| 2026-02-19 | 9,219 | + 1 | - 1 |
| 2026-02-20 | 9,219 | + 4 | - 4 |
| 2026-02-21 | 9,219 | + 2 | - 2 |
| 2026-02-22 | 9,215 | + 4 | - 8 |
| 2026-02-23 | 9,214 | + 1 | - 2 |
| 2026-02-24 | 9,212 | + 3 | - 5 |
| 2026-02-25 | 9,206 | + 2 | - 8 |
| 2026-02-26 | 9,207 | + 6 | - 5 |
| 2026-02-27 | 9,209 | + 5 | - 3 |
| 2026-02-28 | 9,206 | + 2 | - 5 |
| 2026-03-01 | 9,204 | + 3 | - 5 |
| 2026-03-02 | 9,205 | + 4 | - 3 |
| 2026-03-03 | 9,203 | + 3 | - 5 |
| 2026-03-04 | 9,202 | + 1 | - 2 |
| 2026-03-05 | 9,207 | + 12 | - 7 |
| 2026-03-06 | 9,189 | + 1 | - 19 |
| 2026-03-07 | 9,191 | + 6 | - 4 |
| 2026-03-08 | 9,192 | + 5 | - 4 |
| 2026-03-09 | 9,188 | + 1 | - 5 |
| 2026-03-10 | 9,189 | + 3 | - 2 |
| 2026-03-11 | 9,192 | + 6 | - 3 |
| 2026-03-12 | 9,194 | + 4 | - 2 |
| 2026-03-13 | 9,196 | + 3 | - 1 |
| 2026-03-14 | 9,195 | + 2 | - 3 |
| 2026-03-15 | 9,193 | 0 | - 2 |
| 2026-03-16 | 9,190 | + 2 | - 5 |
| 2026-03-17 | 9,194 | + 6 | - 2 |
| 2026-03-18 | 9,193 | + 3 | - 4 |
| 2026-03-19 | 9,193 | + 2 | - 2 |
| 2026-03-20 | 9,193 | + 3 | - 3 |
| 2026-03-21 | 9,193 | + 4 | - 4 |
| 2026-03-22 | 9,188 | 0 | - 5 |
| 2026-03-23 | 9,188 | + 5 | - 5 |
| 2026-03-24 | 9,183 | + 3 | - 8 |
| 2026-03-25 | 9,182 | + 4 | - 5 |
| 2026-03-26 | 9,188 | + 7 | - 1 |
| 2026-03-27 | 9,185 | + 3 | - 6 |
| 2026-03-28 | 9,182 | 0 | - 3 |
| 2026-03-29 | 9,175 | + 1 | - 8 |
| 2026-03-30 | 9,175 | + 3 | - 3 |
| 2026-03-31 | 9,174 | + 3 | - 4 |
| 2026-04-01 | 9,171 | + 4 | - 7 |
| 2026-04-02 | 9,177 | + 10 | - 4 |
| 2026-04-03 | 9,119 | + 6 | - 64 |
| 2026-04-04 | 9,125 | + 6 | 0 |
| 2026-04-05 | 9,125 | + 4 | - 4 |
| 2026-04-06 | 9,127 | + 7 | - 5 |
| 2026-04-07 | 9,125 | + 3 | - 5 |
| 2026-04-08 | 9,123 | + 4 | - 6 |
| 2026-04-09 | 9,130 | + 8 | - 1 |
| 2026-04-10 | 9,129 | + 3 | - 4 |
| 2026-04-11 | 9,132 | + 5 | - 2 |
| 2026-04-12 | 9,134 | + 3 | - 1 |
| 2026-04-13 | 9,135 | + 4 | - 3 |
| 2026-04-14 | 9,137 | + 8 | - 6 |
| 2026-04-15 | 9,140 | + 5 | - 2 |
| 2026-04-16 | 9,142 | + 6 | - 4 |
| 2026-04-17 | 9,140 | + 2 | - 4 |
| 2026-04-18 | 9,139 | + 4 | - 5 |
| 2026-04-19 | 9,141 | + 2 | 0 |
| 2026-04-20 | 9,142 | + 2 | - 1 |
| 2026-04-21 | 9,141 | + 2 | - 3 |
| 2026-04-22 | 9,144 | + 9 | - 6 |
| 2026-04-23 | 9,144 | + 4 | - 4 |
| 2026-04-24 | 9,141 | + 1 | - 4 |
| 2026-04-25 | 9,142 | + 6 | - 5 |
| 2026-04-26 | 9,145 | + 5 | - 2 |
| 2026-04-27 | 9,146 | + 5 | - 4 |
| 2026-04-28 | 9,153 | + 10 | - 3 |
| 2026-04-29 | 9,149 | + 2 | - 6 |
| 2026-04-30 | 9,150 | + 5 | - 4 |
| 2026-05-01 | 9,150 | + 5 | - 5 |
| 2026-05-02 | 9,148 | + 4 | - 6 |
| 2026-05-03 | 9,144 | + 4 | - 8 |
| 2026-05-04 | 9,147 | + 5 | - 2 |
| 2026-05-05 | 9,145 | + 3 | - 5 |
| 2026-05-06 | 9,142 | + 3 | - 6 |
| 2026-05-07 | 9,145 | + 5 | - 2 |
| 2026-05-08 | 9,143 | + 4 | - 6 |
| 2026-05-09 | 9,145 | + 3 | - 1 |
| 2026-05-10 | 9,143 | + 3 | - 5 |
| 2026-05-11 | 9,135 | + 1 | - 9 |
| 2026-05-12 | 9,133 | + 4 | - 6 |
| 2026-05-13 | 9,137 | + 6 | - 2 |
| 2026-05-14 | 9,126 | + 2 | - 13 |
| 2026-05-15 | 9,124 | + 2 | - 4 |
| 2026-05-16 | 9,119 | + 2 | - 7 |
| 2026-05-17 | 9,121 | + 6 | - 4 |
| 2026-05-18 | 9,119 | + 4 | - 6 |
| 2026-05-19 | 9,127 | + 11 | - 3 |
| 2026-05-20 | 9,118 | + 7 | - 16 |
The .healthcare top-level domain is designed for organizations and professionals operating in the health sector: hospitals, clinics, telemedicine platforms, health tech startups, patient portals, research groups, insurers, and wellness providers. Typical use cases include appointment systems, practitioner profiles, service directories, secure patient portals, educational resources, and branded telehealth apps.
From a branding and perception standpoint, .healthcare communicates a focused, industry-specific identity that can increase user trust and clarity compared with generic TLDs. Organizations choose it to make their purpose immediately obvious, to differentiate clinical or regulated services from general consumer offerings, and to support targeted marketing and SEO for health-related queries.
Why choose .healthcare: it provides descriptive clarity, reduces naming competition versus crowded .com options, and helps align the domain with regulatory and professional expectations when paired with clear credentialing and compliance information. Consider operational factors such as verification policies, privacy, and legal obligations for health data when deploying the domain for patient-facing services.
Related zones:
| Zone Name | healthcare |
|---|---|
| Zone Type | gTLD |
| Active | YES |
| WHOIS Server | whois.nic.healthcare |
| RDAP Server | https://rdap.identitydigital.services/rdap/ |
| Managing Organization | Binky Moon, LLC |
| Organization Address |
c/o Identity Digital Limited 10500 NE 8th Street, Suite 750 Bellevue WA 98004 United States of America (the) |
Access the archive of historical .HEALTHCARE zone files and analyze how domains in the .HEALTHCARE namespace have evolved over time. Historical zone data helps researchers and engineers study domain growth, DNS infrastructure changes, and long-term internet trends.
| Date | Domains | File Size | Download |
|---|---|---|---|
| 2026-05-20 | 9,118 | 40 kB | Download |
| 2026-05-19 | 9,127 | 40 kB | Download |
| 2026-05-18 | 9,119 | 40 kB | Download |
| 2026-05-17 | 9,121 | 40 kB | Download |
| 2026-05-16 | 9,119 | 40 kB | Download |
| 2026-05-15 | 9,124 | 40 kB | Download |
| 2026-05-14 | 9,126 | 40 kB | Download |
| 2026-05-13 | 9,137 | 40 kB | Download |
| 2026-05-12 | 9,133 | 40 kB | Download |
| 2026-05-11 | 9,135 | 40 kB | Download |
| 2026-05-10 | 9,143 | 40 kB | Download |
| 2026-05-09 | 9,145 | 40 kB | Download |
| 2026-05-08 | 9,143 | 40 kB | Download |
| 2026-05-07 | 9,145 | 40 kB | Download |
| 2026-05-06 | 9,142 | 40 kB | Download |
| 2026-05-05 | 9,145 | 40 kB | Download |
| 2026-05-04 | 9,147 | 40 kB | Download |
| 2026-05-03 | 9,144 | 40 kB | Download |
| 2026-05-02 | 9,148 | 40 kB | Download |
| 2026-05-01 | 9,150 | 40 kB | Download |
| 2026-04-30 | 9,150 | 40 kB | Download |
| 2026-04-29 | 9,149 | 40 kB | Download |
| 2026-04-28 | 9,153 | 40 kB | Download |
| 2026-04-27 | 9,146 | 40 kB | Download |
| 2026-04-26 | 9,145 | 40 kB | Download |
| 2026-04-25 | 9,142 | 40 kB | Download |
| 2026-04-24 | 9,141 | 40 kB | Download |
| 2026-04-23 | 9,144 | 40 kB | Download |
| 2026-04-22 | 9,144 | 40 kB | Download |
| 2026-04-21 | 9,141 | 40 kB | Download |
| 2026-04-20 | 9,142 | 40 kB | Download |
| 2026-04-19 | 9,141 | 40 kB | Download |
| 2026-04-18 | 9,139 | 40 kB | Download |
| 2026-04-17 | 9,140 | 40 kB | Download |
| 2026-04-16 | 9,142 | 40 kB | Download |
| 2026-04-15 | 9,140 | 40 kB | Download |
| 2026-04-14 | 9,137 | 40 kB | Download |
| 2026-04-13 | 9,135 | 40 kB | Download |
| 2026-04-12 | 9,134 | 40 kB | Download |
| 2026-04-11 | 9,132 | 40 kB | Download |
| 2026-04-10 | 9,129 | 40 kB | Download |
| 2026-04-09 | 9,130 | 40 kB | Download |
| 2026-04-08 | 9,123 | 40 kB | Download |
| 2026-04-07 | 9,125 | 40 kB | Download |
| 2026-04-06 | 9,127 | 40 kB | Download |
| 2026-04-05 | 9,125 | 40 kB | Download |
| 2026-04-04 | 9,125 | 40 kB | Download |
| 2026-04-03 | 9,119 | 40 kB | Download |
| 2026-04-02 | 9,177 | 40 kB | Download |
| 2026-04-01 | 9,171 | 40 kB | Download |
| 2026-03-31 | 9,174 | 40 kB | Download |
| 2026-03-30 | 9,175 | 40 kB | Download |
| 2026-03-29 | 9,175 | 40 kB | Download |
| 2026-03-28 | 9,182 | 40 kB | Download |
| 2026-03-27 | 9,185 | 40 kB | Download |
| 2026-03-26 | 9,188 | 40 kB | Download |
| 2026-03-25 | 9,182 | 40 kB | Download |
| 2026-03-24 | 9,183 | 40 kB | Download |
| 2026-03-23 | 9,188 | 40 kB | Download |
| 2026-03-22 | 9,188 | 40 kB | Download |
| 2026-03-21 | 9,193 | 40 kB | Download |
| 2026-03-20 | 9,193 | 40 kB | Download |
| 2026-03-19 | 9,193 | 40 kB | Download |
| 2026-03-18 | 9,193 | 40 kB | Download |
| 2026-03-17 | 9,194 | 40 kB | Download |
| 2026-03-16 | 9,190 | 40 kB | Download |
| 2026-03-15 | 9,193 | 40 kB | Download |
| 2026-03-14 | 9,195 | 40 kB | Download |
| 2026-03-13 | 9,196 | 40 kB | Download |
| 2026-03-12 | 9,194 | 40 kB | Download |
| 2026-03-11 | 9,192 | 40 kB | Download |
| 2026-03-10 | 9,189 | 40 kB | Download |
| 2026-03-09 | 9,188 | 40 kB | Download |
| 2026-03-08 | 9,192 | 40 kB | Download |
| 2026-03-07 | 9,191 | 40 kB | Download |
| 2026-03-06 | 9,189 | 40 kB | Download |
| 2026-03-05 | 9,207 | 40 kB | Download |
| 2026-03-04 | 9,202 | 40 kB | Download |
| 2026-03-03 | 9,203 | 40 kB | Download |
| 2026-03-02 | 9,205 | 40 kB | Download |
| 2026-03-01 | 9,204 | 40 kB | Download |
| 2026-02-28 | 9,206 | 40 kB | Download |
| 2026-02-27 | 9,209 | 40 kB | Download |
| 2026-02-26 | 9,207 | 40 kB | Download |
| 2026-02-25 | 9,206 | 40 kB | Download |
| 2026-02-24 | 9,212 | 40 kB | Download |
| 2026-02-23 | 9,214 | 40 kB | Download |
| 2026-02-22 | 9,215 | 40 kB | Download |
| 2026-02-21 | 9,219 | 40 kB | Download |
| 2026-02-20 | 9,219 | 40 kB | Download |
| 2026-02-19 | 9,219 | 40 kB | Download |
| 2026-02-18 | 9,219 | 40 kB | Download |
| 2026-02-17 | 9,220 | 40 kB | Download |
| 2026-02-16 | 9,218 | 40 kB | Download |
| 2026-02-15 | 9,221 | 40 kB | Download |
| 2026-02-14 | 9,228 | 40 kB | Download |
| 2026-02-13 | 9,228 | 40 kB | Download |
| 2026-02-12 | 9,223 | 40 kB | Download |
| 2026-02-11 | 9,228 | 40 kB | Download |
| 2026-02-10 | 9,229 | 40 kB | Download |
| 2026-02-09 | 9,230 | 40 kB | Download |
| 2026-02-08 | 9,235 | 40 kB | Download |
| 2026-02-07 | 9,231 | 40 kB | Download |
| 2026-02-06 | 9,230 | 40 kB | Download |
| 2026-02-05 | 9,231 | 40 kB | Download |
| 2026-02-04 | 9,229 | 40 kB | Download |
| 2026-02-03 | 9,233 | 40 kB | Download |
| 2026-02-02 | 9,230 | 40 kB | Download |
| 2026-02-01 | 9,230 | 40 kB | Download |
| 2026-01-31 | 9,235 | 40 kB | Download |
| 2026-01-30 | 9,235 | 40 kB | Download |
| 2026-01-29 | 9,227 | 40 kB | Download |
| 2026-01-28 | 9,223 | 40 kB | Download |
| 2026-01-27 | 9,223 | 40 kB | Download |
| 2026-01-26 | 9,222 | 40 kB | Download |
| 2026-01-25 | 9,224 | 40 kB | Download |
| 2026-01-24 | 9,226 | 40 kB | Download |
| 2026-01-23 | 9,224 | 40 kB | Download |
| 2026-01-22 | 9,221 | 40 kB | Download |
| 2026-01-21 | 9,221 | 40 kB | Download |
| 2026-01-20 | 9,226 | 40 kB | Download |
| 2026-01-19 | 9,224 | 40 kB | Download |
| 2026-01-18 | 9,226 | 40 kB | Download |
| 2026-01-17 | 9,229 | 40 kB | Download |
| 2026-01-16 | 9,227 | 40 kB | Download |
| 2026-01-15 | 9,225 | 40 kB | Download |
| 2026-01-14 | 9,222 | 40 kB | Download |
| 2026-01-13 | 9,225 | 40 kB | Download |
| 2026-01-12 | 9,224 | 40 kB | Download |
| 2026-01-11 | 9,223 | 40 kB | Download |
| 2026-01-10 | 9,223 | 40 kB | Download |
| 2026-01-09 | 9,221 | 40 kB | Download |
| 2026-01-08 | 9,221 | 40 kB | Download |
| 2026-01-07 | 9,222 | 40 kB | Download |
| 2026-01-06 | 9,226 | 40 kB | Download |
| 2026-01-05 | 9,229 | 40 kB | Download |
| 2026-01-04 | 9,232 | 40 kB | Download |
| 2026-01-03 | 9,234 | 40 kB | Download |
| 2026-01-02 | 9,234 | 40 kB | Download |
| 2026-01-01 | 9,236 | 40 kB | Download |
| 2025-12-31 | 9,242 | 40 kB | Download |
| 2025-12-30 | 9,243 | 40 kB | Download |
| 2025-12-29 | 9,244 | 40 kB | Download |
| 2025-12-28 | 9,245 | 40 kB | Download |
| 2025-12-27 | 9,241 | 40 kB | Download |
| 2025-12-26 | 9,245 | 40 kB | Download |
| 2025-12-25 | 9,250 | 40 kB | Download |
| 2025-12-24 | 9,252 | 40 kB | Download |
| 2025-12-23 | 9,255 | 40 kB | Download |
| 2025-12-22 | 9,253 | 40 kB | Download |
| 2025-12-21 | 9,260 | 40 kB | Download |
| 2025-12-20 | 9,256 | 40 kB | Download |
| 2025-12-19 | 9,257 | 40 kB | Download |
| 2025-12-18 | 9,256 | 40 kB | Download |
| 2025-12-17 | 9,255 | 40 kB | Download |
| 2025-12-16 | 9,252 | 40 kB | Download |
| 2025-12-15 | 9,251 | 40 kB | Download |
| 2025-12-14 | 9,253 | 40 kB | Download |
| 2025-12-13 | 9,257 | 40 kB | Download |
| 2025-12-12 | 9,265 | 40 kB | Download |
| 2025-12-11 | 9,264 | 40 kB | Download |
| 2025-12-10 | 9,267 | 40 kB | Download |
| 2025-12-09 | 9,269 | 40 kB | Download |
| 2025-12-08 | 9,269 | 40 kB | Download |
| 2025-12-07 | 9,272 | 40 kB | Download |
| 2025-12-06 | 9,271 | 40 kB | Download |
| 2025-12-05 | 9,275 | 40 kB | Download |
| 2025-12-04 | 9,281 | 40 kB | Download |
| 2025-12-03 | 9,293 | 40 kB | Download |
| 2025-12-02 | 9,291 | 40 kB | Download |
| 2025-12-01 | 9,299 | 40 kB | Download |
| 2025-11-30 | 9,303 | 40 kB | Download |
| 2025-11-29 | 9,303 | 40 kB | Download |
| 2025-11-28 | 9,299 | 40 kB | Download |
| 2025-11-27 | 9,299 | 40 kB | Download |
| 2025-11-26 | 9,299 | 40 kB | Download |
| 2025-11-25 | 9,298 | 40 kB | Download |
| 2025-11-24 | 9,297 | 40 kB | Download |
| 2025-11-23 | 9,297 | 40 kB | Download |
| 2025-11-22 | 9,305 | 41 kB | Download |
| 2025-11-21 | 9,306 | 41 kB | Download |
| 2025-11-20 | 9,305 | 41 kB | Download |
| 2025-11-19 | 9,300 | 41 kB | Download |
| 2025-11-18 | 9,306 | 41 kB | Download |
| 2025-11-17 | 9,306 | 41 kB | Download |
| 2025-11-16 | 9,301 | 41 kB | Download |
| 2025-11-15 | 9,302 | 41 kB | Download |
| 2025-11-14 | 9,302 | 41 kB | Download |
| 2025-11-13 | 9,305 | 41 kB | Download |
| 2025-11-12 | 9,306 | 41 kB | Download |
| 2025-11-11 | 9,306 | 41 kB | Download |
| 2025-11-10 | 9,308 | 41 kB | Download |
| 2025-11-09 | 9,306 | 41 kB | Download |
| 2025-11-08 | 9,309 | 41 kB | Download |
| 2025-11-07 | 9,298 | 41 kB | Download |
| 2025-11-06 | 9,300 | 41 kB | Download |
| 2025-11-05 | 9,303 | 41 kB | Download |
| 2025-11-04 | 9,301 | 41 kB | Download |
| 2025-11-03 | 9,300 | 41 kB | Download |
| 2025-11-02 | 9,303 | 41 kB | Download |
| 2025-11-01 | 9,306 | 41 kB | Download |
| 2025-10-31 | 9,303 | 41 kB | Download |
| 2025-10-30 | 9,300 | 41 kB | Download |
| 2025-10-29 | 9,304 | 41 kB | Download |
| 2025-10-28 | 9,294 | 40 kB | Download |
| 2025-10-27 | 9,298 | 41 kB | Download |
| 2025-10-26 | 9,300 | 41 kB | Download |
| 2025-10-25 | 9,302 | 41 kB | Download |
| 2025-10-24 | 9,306 | 41 kB | Download |
| 2025-10-23 | 9,310 | 41 kB | Download |
| 2025-10-22 | 9,313 | 41 kB | Download |
| 2025-10-21 | 9,316 | 41 kB | Download |
| 2025-10-20 | 9,320 | 41 kB | Download |
| 2025-10-19 | 9,325 | 41 kB | Download |
| 2025-10-18 | 9,325 | 41 kB | Download |
| 2025-10-17 | 9,322 | 41 kB | Download |
| 2025-10-16 | 9,324 | 41 kB | Download |
| 2025-10-15 | 9,324 | 41 kB | Download |
| 2025-10-14 | 9,322 | 41 kB | Download |
| 2025-10-13 | 9,324 | 41 kB | Download |
| 2025-10-12 | 9,326 | 41 kB | Download |
| 2025-10-11 | 9,328 | 41 kB | Download |
| 2025-10-10 | 9,331 | 41 kB | Download |
| 2025-10-09 | 9,330 | 41 kB | Download |
| 2025-10-08 | 9,329 | 41 kB | Download |
| 2025-10-07 | 9,335 | 41 kB | Download |
| 2025-10-06 | 9,330 | 41 kB | Download |
| 2025-10-05 | 9,334 | 41 kB | Download |
| 2025-10-04 | 9,336 | 41 kB | Download |
| 2025-10-03 | 9,332 | 41 kB | Download |
| 2025-10-02 | 9,333 | 41 kB | Download |
| 2025-10-01 | 9,328 | 41 kB | Download |
| 2025-09-30 | 9,328 | 41 kB | Download |
| 2025-09-29 | 9,321 | 41 kB | Download |
| 2025-09-28 | 9,322 | 41 kB | Download |
| 2025-09-27 | 9,321 | 41 kB | Download |
| 2025-09-26 | 9,324 | 41 kB | Download |
| 2025-09-25 | 9,323 | 41 kB | Download |
| 2025-09-24 | 9,318 | 41 kB | Download |
| 2025-09-23 | 9,320 | 41 kB | Download |
| 2025-09-22 | 9,320 | 41 kB | Download |
| 2025-09-21 | 9,319 | 41 kB | Download |
| 2025-09-20 | 9,324 | 41 kB | Download |
| 2025-09-19 | 9,325 | 41 kB | Download |
| 2025-09-18 | 9,327 | 41 kB | Download |
| 2025-09-17 | 9,323 | 41 kB | Download |
| 2025-09-16 | 9,326 | 41 kB | Download |
| 2025-09-15 | 9,324 | 41 kB | Download |
| 2025-09-14 | 9,324 | 41 kB | Download |
| 2025-09-13 | 9,326 | 41 kB | Download |
| 2025-09-12 | 9,323 | 41 kB | Download |
| 2025-09-11 | 9,328 | 41 kB | Download |
| 2025-09-10 | 9,330 | 41 kB | Download |
| 2025-09-09 | 9,328 | 41 kB | Download |
| 2025-09-08 | 9,324 | 41 kB | Download |
| 2025-09-07 | 9,329 | 41 kB | Download |
| 2025-09-06 | 9,336 | 41 kB | Download |
| 2025-09-05 | 9,332 | 41 kB | Download |
| 2025-09-04 | 9,254 | 40 kB | Download |
| 2025-09-03 | 9,252 | 40 kB | Download |
| 2025-09-02 | 9,252 | 40 kB | Download |
| 2025-09-01 | 9,251 | 40 kB | Download |
| 2025-08-31 | 9,250 | 40 kB | Download |
| 2025-08-30 | 9,262 | 40 kB | Download |
| 2025-08-29 | 9,265 | 40 kB | Download |
| 2025-08-28 | 9,272 | 40 kB | Download |
| 2025-08-27 | 9,270 | 40 kB | Download |
| 2025-08-26 | 9,274 | 40 kB | Download |
| 2025-08-25 | 9,278 | 40 kB | Download |
| 2025-08-24 | 9,274 | 40 kB | Download |
| 2025-08-23 | 9,278 | 40 kB | Download |
| 2025-08-22 | 9,280 | 40 kB | Download |
| 2025-08-21 | 9,281 | 40 kB | Download |
| 2025-08-20 | 9,280 | 40 kB | Download |
| 2025-08-19 | 9,278 | 40 kB | Download |
| 2025-08-18 | 9,277 | 40 kB | Download |
| 2025-08-17 | 9,283 | 40 kB | Download |
| 2025-08-16 | 9,288 | 40 kB | Download |
| 2025-08-15 | 9,288 | 40 kB | Download |
| 2025-08-14 | 9,284 | 40 kB | Download |
| 2025-08-13 | 9,287 | 40 kB | Download |
| 2025-08-12 | 9,286 | 40 kB | Download |
| 2025-08-11 | 9,286 | 40 kB | Download |
| 2025-08-10 | 9,287 | 40 kB | Download |
| 2025-08-09 | 9,287 | 40 kB | Download |
| 2025-08-08 | 9,289 | 40 kB | Download |
| 2025-08-07 | 9,287 | 40 kB | Download |
| 2025-08-06 | 9,290 | 40 kB | Download |
| 2025-08-05 | 9,291 | 40 kB | Download |
| 2025-08-04 | 9,291 | 40 kB | Download |
| 2025-08-03 | 9,294 | 40 kB | Download |
| 2025-08-02 | 9,296 | 40 kB | Download |
| 2025-08-01 | 9,298 | 40 kB | Download |
| 2025-07-31 | 9,293 | 40 kB | Download |
| 2025-07-30 | 9,300 | 40 kB | Download |
| 2025-07-29 | 9,292 | 40 kB | Download |
| 2025-07-28 | 9,285 | 40 kB | Download |
| 2025-07-27 | 9,291 | 40 kB | Download |
| 2025-07-26 | 9,296 | 40 kB | Download |
| 2025-07-25 | 9,300 | 40 kB | Download |
| 2025-07-24 | 9,298 | 40 kB | Download |
| 2025-07-23 | 9,310 | 40 kB | Download |
| 2025-07-22 | 9,307 | 40 kB | Download |
| 2025-07-21 | 9,308 | 40 kB | Download |
| 2025-07-20 | 9,302 | 40 kB | Download |
| 2025-07-19 | 9,305 | 40 kB | Download |
| 2025-07-18 | 9,307 | 40 kB | Download |
| 2025-07-17 | 9,312 | 40 kB | Download |
| 2025-07-16 | 9,313 | 40 kB | Download |
| 2025-07-14 | 9,317 | 40 kB | Download |
| 2025-07-13 | 9,318 | 40 kB | Download |
| 2025-07-12 | 9,321 | 40 kB | Download |
| 2025-07-11 | 9,327 | 40 kB | Download |
| 2025-07-10 | 9,331 | 40 kB | Download |
| 2025-07-09 | 9,334 | 40 kB | Download |
| 2025-07-08 | 9,339 | 41 kB | Download |
| 2025-07-07 | 9,336 | 40 kB | Download |
| 2025-07-06 | 9,337 | 40 kB | Download |
| 2025-07-05 | 9,339 | 41 kB | Download |
| 2025-07-04 | 9,339 | 41 kB | Download |
| 2025-07-03 | 9,342 | 41 kB | Download |
| 2025-07-02 | 9,341 | 41 kB | Download |
| 2025-07-01 | 9,343 | 41 kB | Download |
| 2025-06-30 | 9,339 | 40 kB | Download |
| 2025-06-29 | 9,345 | 41 kB | Download |
| 2025-06-28 | 9,347 | 41 kB | Download |
| 2025-06-27 | 9,351 | 41 kB | Download |
| 2025-06-26 | 9,349 | 41 kB | Download |
| 2025-06-25 | 9,351 | 41 kB | Download |
| 2025-06-24 | 9,345 | 41 kB | Download |
| 2025-06-23 | 9,345 | 41 kB | Download |
| 2025-06-22 | 9,347 | 41 kB | Download |
import axios from 'axios';
import fs from 'fs';
import { pipeline } from 'stream/promises';
const response = await axios({
method: 'GET',
url: 'https://allzonefiles.io/api/v1/zones/healthcare/dl',
responseType: 'stream',
headers: {
// Replace with your API key
'Authorization': 'Bearer allzfio_5c1572d016b846ce99ce7a177922ff21'
}
});
await pipeline(response.data, fs.createWriteStream('healthcare.txt.gz'));
console.log('Download complete!');
package main
import (
"io"
"net/http"
"os"
)
func main() {
url := "https://allzonefiles.io/api/v1/zones/healthcare/dl"
file, _ := os.Create("healthcare.txt.gz")
defer out.Close()
req, _ := http.NewRequest("GET", url, nil)
// Replace with your API key
req.Header.Set("Authorization", "Bearer allzfio_5c1572d016b846ce99ce7a177922ff21")
resp, _ := http.DefaultClient.Do(req)
defer resp.Body.Close()
io.Copy(out, resp.Body)
}
import requests
url = "https://allzonefiles.io/api/v1/zones/healthcare/dl"
# Replace with your API key
headers = {"Authorization": "Bearer allzfio_5c1572d016b846ce99ce7a177922ff21"}
with requests.get(url, headers=headers, stream=True) as r:
r.raise_for_status()
with open("healthcare.txt.gz", "wb") as f:
for chunk in r.iter_content(chunk_size=128*1024):
f.write(chunk)
import java.io.FileOutputStream;
import java.io.InputStream;
import java.net.HttpURLConnection;
import java.net.URL;
public class FileDownloader {
public static void main(String[] args) throws Exception {
URL url = new URL("https://allzonefiles.io/api/v1/zones/healthcare/dl");
HttpURLConnection connection = (HttpURLConnection) url.openConnection();
connection.setRequestMethod("GET");
// Replace with your API key
connection.setRequestProperty("Authorization", "Bearer allzfio_5c1572d016b846ce99ce7a177922ff21");
try (InputStream in = connection.getInputStream();
FileOutputStream out = new FileOutputStream("healthcare.txt.gz")) {
byte[] buffer = new byte[8192];
int bytesRead;
while ((bytesRead = in.read(buffer)) != -1) {
out.write(buffer, 0, bytesRead);
}
}
System.out.println("Download complete!");
}
}